UNC119 monoclonal antibody (M01A), clone 2F9-2A9 View larger

UNC119 monoclonal antibody (M01A), clone 2F9-2A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UNC119 monoclonal antibody (M01A), clone 2F9-2A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about UNC119 monoclonal antibody (M01A), clone 2F9-2A9

Brand: Abnova
Reference: H00009094-M01A
Product name: UNC119 monoclonal antibody (M01A), clone 2F9-2A9
Product description: Mouse monoclonal antibody raised against a full-length recombinant UNC119.
Clone: 2F9-2A9
Isotype: IgG1 Kappa
Gene id: 9094
Gene name: UNC119
Gene alias: HRG4
Gene description: unc-119 homolog (C. elegans)
Genbank accession: BC027176
Immunogen: UNC119 (AAH27176.1, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Protein accession: AAH27176.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009094-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (52.14 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009094-M01A-13-15-1.jpg
Application image note: Western Blot analysis of UNC119 expression in transfected 293T cell line by UNC119 monoclonal antibody (M01A), clone 2F9-2A9.

Lane 1: UNC119 transfected lysate(27 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UNC119 monoclonal antibody (M01A), clone 2F9-2A9 now

Add to cart