H00009094-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00009094-M01 |
Product name: | UNC119 monoclonal antibody (M01), clone 2F9-2A9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant UNC119. |
Clone: | 2F9-2A9 |
Isotype: | IgG1 kappa |
Gene id: | 9094 |
Gene name: | UNC119 |
Gene alias: | HRG4 |
Gene description: | unc-119 homolog (C. elegans) |
Genbank accession: | BC027176 |
Immunogen: | UNC119 (AAH27176.1, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP |
Protein accession: | AAH27176.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (52.14 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of UNC119 expression in transfected 293T cell line by UNC119 monoclonal antibody (M01), clone 2F9-2A9. Lane 1: UNC119 transfected lysate(27 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |