PIGQ monoclonal antibody (M02), clone 2B7 View larger

PIGQ monoclonal antibody (M02), clone 2B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIGQ monoclonal antibody (M02), clone 2B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PIGQ monoclonal antibody (M02), clone 2B7

Brand: Abnova
Reference: H00009091-M02
Product name: PIGQ monoclonal antibody (M02), clone 2B7
Product description: Mouse monoclonal antibody raised against a partial recombinant PIGQ.
Clone: 2B7
Isotype: IgG2a Kappa
Gene id: 9091
Gene name: PIGQ
Gene alias: GPI1|MGC12693|c407A10.1|hGPI1
Gene description: phosphatidylinositol glycan anchor biosynthesis, class Q
Genbank accession: NM_148920
Immunogen: PIGQ (NP_683721.1, 661 a.a. ~ 758 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGVEGPCQDEPPSPRHPLAPSAEQHPASGGLKQSLTPVPSGPGPSLPEPHGVYLRMFPGEV
Protein accession: NP_683721.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009091-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009091-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PIGQ is approximately 0.1ng/ml as a capture antibody.
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PIGQ monoclonal antibody (M02), clone 2B7 now

Add to cart