Brand: | Abnova |
Reference: | H00009091-M02 |
Product name: | PIGQ monoclonal antibody (M02), clone 2B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIGQ. |
Clone: | 2B7 |
Isotype: | IgG2a Kappa |
Gene id: | 9091 |
Gene name: | PIGQ |
Gene alias: | GPI1|MGC12693|c407A10.1|hGPI1 |
Gene description: | phosphatidylinositol glycan anchor biosynthesis, class Q |
Genbank accession: | NM_148920 |
Immunogen: | PIGQ (NP_683721.1, 661 a.a. ~ 758 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGVEGPCQDEPPSPRHPLAPSAEQHPASGGLKQSLTPVPSGPGPSLPEPHGVYLRMFPGEV |
Protein accession: | NP_683721.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PIGQ is approximately 0.1ng/ml as a capture antibody. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |