PKMYT1 monoclonal antibody (M03), clone 2A3 View larger

PKMYT1 monoclonal antibody (M03), clone 2A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PKMYT1 monoclonal antibody (M03), clone 2A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,PLA-Ce

More info about PKMYT1 monoclonal antibody (M03), clone 2A3

Brand: Abnova
Reference: H00009088-M03
Product name: PKMYT1 monoclonal antibody (M03), clone 2A3
Product description: Mouse monoclonal antibody raised against a partial recombinant PKMYT1.
Clone: 2A3
Isotype: IgG2a Kappa
Gene id: 9088
Gene name: PKMYT1
Gene alias: DKFZp547K1610|FLJ20093|MYT1
Gene description: protein kinase, membrane associated tyrosine/threonine 1
Genbank accession: NM_004203
Immunogen: PKMYT1 (NP_004194.3, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PASWLQPLGPPATPPGSPPCSLLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLSLFEDTLDPT
Protein accession: NP_004194.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009088-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009088-M03-57-201-1.jpg
Application image note: Proximity Ligation Analysis of protein-protein interactions between CCNB1 and PKMYT1. Huh7 cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and anti-PKMYT1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Applications: S-ELISA,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy PKMYT1 monoclonal antibody (M03), clone 2A3 now

Add to cart