TMSB4Y monoclonal antibody (M05), clone 6G4 View larger

TMSB4Y monoclonal antibody (M05), clone 6G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMSB4Y monoclonal antibody (M05), clone 6G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TMSB4Y monoclonal antibody (M05), clone 6G4

Brand: Abnova
Reference: H00009087-M05
Product name: TMSB4Y monoclonal antibody (M05), clone 6G4
Product description: Mouse monoclonal antibody raised against a full-length recombinant TMSB4Y.
Clone: 6G4
Isotype: IgG2a Kappa
Gene id: 9087
Gene name: TMSB4Y
Gene alias: MGC26307|TB4Y
Gene description: thymosin beta 4, Y-linked
Genbank accession: NM_004202.2
Immunogen: TMSB4Y (NP_004193.1, 1 a.a. ~ 44 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
Protein accession: NP_004193.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009087-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009087-M05-13-15-1.jpg
Application image note: Western Blot analysis of TMSB4Y expression in transfected 293T cell line by TMSB4Y monoclonal antibody (M05), clone 6G4.

Lane 1: TMSB4Y transfected lysate(5 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TMSB4Y monoclonal antibody (M05), clone 6G4 now

Add to cart