EIF1AY monoclonal antibody (M03), clone 2B8 View larger

EIF1AY monoclonal antibody (M03), clone 2B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EIF1AY monoclonal antibody (M03), clone 2B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about EIF1AY monoclonal antibody (M03), clone 2B8

Brand: Abnova
Reference: H00009086-M03
Product name: EIF1AY monoclonal antibody (M03), clone 2B8
Product description: Mouse monoclonal antibody raised against a partial recombinant EIF1AY.
Clone: 2B8
Isotype: IgG2a Kappa
Gene id: 9086
Gene name: EIF1AY
Gene alias: -
Gene description: eukaryotic translation initiation factor 1A, Y-linked
Genbank accession: NM_004681
Immunogen: EIF1AY (NP_004672, 31 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
Protein accession: NP_004672
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009086-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009086-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to EIF1AY on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EIF1AY monoclonal antibody (M03), clone 2B8 now

Add to cart