EIF1AY monoclonal antibody (M01), clone 1B4 View larger

EIF1AY monoclonal antibody (M01), clone 1B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EIF1AY monoclonal antibody (M01), clone 1B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re,WB-Tr

More info about EIF1AY monoclonal antibody (M01), clone 1B4

Brand: Abnova
Reference: H00009086-M01
Product name: EIF1AY monoclonal antibody (M01), clone 1B4
Product description: Mouse monoclonal antibody raised against a partial recombinant EIF1AY.
Clone: 1B4
Isotype: IgG2a Kappa
Gene id: 9086
Gene name: EIF1AY
Gene alias: -
Gene description: eukaryotic translation initiation factor 1A, Y-linked
Genbank accession: BC005248
Immunogen: EIF1AY (NP_004672.2, 22 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKY
Protein accession: NP_004672.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009086-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.88 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009086-M01-13-15-1.jpg
Application image note: Western Blot analysis of EIF1AY expression in transfected 293T cell line by EIF1AY monoclonal antibody (M01), clone 1B4.

Lane 1: EIF1AY transfected lysate(16.4 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EIF1AY monoclonal antibody (M01), clone 1B4 now

Add to cart