Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009086-M01 |
Product name: | EIF1AY monoclonal antibody (M01), clone 1B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF1AY. |
Clone: | 1B4 |
Isotype: | IgG2a Kappa |
Gene id: | 9086 |
Gene name: | EIF1AY |
Gene alias: | - |
Gene description: | eukaryotic translation initiation factor 1A, Y-linked |
Genbank accession: | BC005248 |
Immunogen: | EIF1AY (NP_004672.2, 22 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKY |
Protein accession: | NP_004672.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of EIF1AY expression in transfected 293T cell line by EIF1AY monoclonal antibody (M01), clone 1B4. Lane 1: EIF1AY transfected lysate(16.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |