Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009077-M01A |
Product name: | DIRAS3 monoclonal antibody (M01A), clone 1G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DIRAS3. |
Clone: | 1G4 |
Isotype: | IgM kappa |
Gene id: | 9077 |
Gene name: | DIRAS3 |
Gene alias: | ARHI|NOEY2 |
Gene description: | DIRAS family, GTP-binding RAS-like 3 |
Genbank accession: | NM_004675 |
Immunogen: | DIRAS3 (NP_004666, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM |
Protein accession: | NP_004666 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of DIRAS3 expression in transfected 293T cell line by DIRAS3 monoclonal antibody (M01A), clone 1G4. Lane 1: DIRAS3 transfected lysate (Predicted MW: 25.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |