DIRAS3 monoclonal antibody (M01A), clone 1G4 View larger

DIRAS3 monoclonal antibody (M01A), clone 1G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DIRAS3 monoclonal antibody (M01A), clone 1G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about DIRAS3 monoclonal antibody (M01A), clone 1G4

Brand: Abnova
Reference: H00009077-M01A
Product name: DIRAS3 monoclonal antibody (M01A), clone 1G4
Product description: Mouse monoclonal antibody raised against a partial recombinant DIRAS3.
Clone: 1G4
Isotype: IgM kappa
Gene id: 9077
Gene name: DIRAS3
Gene alias: ARHI|NOEY2
Gene description: DIRAS family, GTP-binding RAS-like 3
Genbank accession: NM_004675
Immunogen: DIRAS3 (NP_004666, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Protein accession: NP_004666
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009077-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009077-M01A-13-15-1.jpg
Application image note: Western Blot analysis of DIRAS3 expression in transfected 293T cell line by DIRAS3 monoclonal antibody (M01A), clone 1G4.

Lane 1: DIRAS3 transfected lysate (Predicted MW: 25.9 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DIRAS3 monoclonal antibody (M01A), clone 1G4 now

Add to cart