Reference: | H00009071-P01 |
Product name: | CLDN10 (Human) Recombinant Protein (P01) |
Product description: | Human CLDN10 full-length ORF ( NP_008915.1, 1 a.a. - 228 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 9071 |
Gene name: | CLDN10 |
Gene alias: | CPETRL3|OSP-L |
Gene description: | claudin 10 |
Genbank accession: | NM_006984.3 |
Immunogen sequence/protein sequence: | MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV |
Protein accession: | NP_008915.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Shipping condition: | Dry Ice |