ASH2L monoclonal antibody (M21A), clone 1B4 View larger

ASH2L monoclonal antibody (M21A), clone 1B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ASH2L monoclonal antibody (M21A), clone 1B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ASH2L monoclonal antibody (M21A), clone 1B4

Brand: Abnova
Reference: H00009070-M21A
Product name: ASH2L monoclonal antibody (M21A), clone 1B4
Product description: Mouse monoclonal antibody raised against a partial recombinant ASH2L.
Clone: 1B4
Isotype: IgG2b Kappa
Gene id: 9070
Gene name: ASH2L
Gene alias: ASH2|ASH2L1|ASH2L2|Bre2
Gene description: ash2 (absent, small, or homeotic)-like (Drosophila)
Genbank accession: NM_004674
Immunogen: ASH2L (NP_004665.1, 424 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAE
Protein accession: NP_004665.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009070-M21A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009070-M21A-1-6-1.jpg
Application image note: ASH2L monoclonal antibody (M21A), clone 1B4. Western Blot analysis of ASH2L expression in Jurkat(Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ASH2L monoclonal antibody (M21A), clone 1B4 now

Add to cart