H00009070-M21A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009070-M21A |
Product name: | ASH2L monoclonal antibody (M21A), clone 1B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ASH2L. |
Clone: | 1B4 |
Isotype: | IgG2b Kappa |
Gene id: | 9070 |
Gene name: | ASH2L |
Gene alias: | ASH2|ASH2L1|ASH2L2|Bre2 |
Gene description: | ash2 (absent, small, or homeotic)-like (Drosophila) |
Genbank accession: | NM_004674 |
Immunogen: | ASH2L (NP_004665.1, 424 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAE |
Protein accession: | NP_004665.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | ASH2L monoclonal antibody (M21A), clone 1B4. Western Blot analysis of ASH2L expression in Jurkat(Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |