Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ASH2L monoclonal antibody (M21A), clone 1B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ASH2L monoclonal antibody (M21A), clone 1B4
| Brand: | Abnova |
| Reference: | H00009070-M21A |
| Product name: | ASH2L monoclonal antibody (M21A), clone 1B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ASH2L. |
| Clone: | 1B4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9070 |
| Gene name: | ASH2L |
| Gene alias: | ASH2|ASH2L1|ASH2L2|Bre2 |
| Gene description: | ash2 (absent, small, or homeotic)-like (Drosophila) |
| Genbank accession: | NM_004674 |
| Immunogen: | ASH2L (NP_004665.1, 424 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAE |
| Protein accession: | NP_004665.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ASH2L monoclonal antibody (M21A), clone 1B4. Western Blot analysis of ASH2L expression in Jurkat(Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |