ASH2L monoclonal antibody (M09), clone 4G7 View larger

ASH2L monoclonal antibody (M09), clone 4G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ASH2L monoclonal antibody (M09), clone 4G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ASH2L monoclonal antibody (M09), clone 4G7

Brand: Abnova
Reference: H00009070-M09
Product name: ASH2L monoclonal antibody (M09), clone 4G7
Product description: Mouse monoclonal antibody raised against a partial recombinant ASH2L.
Clone: 4G7
Isotype: IgG2a Kappa
Gene id: 9070
Gene name: ASH2L
Gene alias: ASH2|ASH2L1|ASH2L2|Bre2
Gene description: ash2 (absent, small, or homeotic)-like (Drosophila)
Genbank accession: NM_004674
Immunogen: ASH2L (NP_004665.1, 424 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAE
Protein accession: NP_004665.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009070-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009070-M09-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ASH2L is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ASH2L monoclonal antibody (M09), clone 4G7 now

Add to cart