CLDN12 monoclonal antibody (M01), clone 2D8 View larger

CLDN12 monoclonal antibody (M01), clone 2D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLDN12 monoclonal antibody (M01), clone 2D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CLDN12 monoclonal antibody (M01), clone 2D8

Brand: Abnova
Reference: H00009069-M01
Product name: CLDN12 monoclonal antibody (M01), clone 2D8
Product description: Mouse monoclonal antibody raised against a full-length recombinant CLDN12.
Clone: 2D8
Isotype: IgG2a Kappa
Gene id: 9069
Gene name: CLDN12
Gene alias: -
Gene description: claudin 12
Genbank accession: BC036754
Immunogen: CLDN12 (AAH36754.1, 1 a.a. ~ 244 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT
Protein accession: AAH36754.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009069-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CLDN12 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CLDN12 monoclonal antibody (M01), clone 2D8 now

Add to cart