ANGPTL1 monoclonal antibody (M01), clone 1C2 View larger

ANGPTL1 monoclonal antibody (M01), clone 1C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANGPTL1 monoclonal antibody (M01), clone 1C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ANGPTL1 monoclonal antibody (M01), clone 1C2

Brand: Abnova
Reference: H00009068-M01
Product name: ANGPTL1 monoclonal antibody (M01), clone 1C2
Product description: Mouse monoclonal antibody raised against a full-length recombinant ANGPTL1.
Clone: 1C2
Isotype: IgG2a Kappa
Gene id: 9068
Gene name: ANGPTL1
Gene alias: ANG3|ANGPT3|ARP1|AngY|KIAA0351|UNQ162|dJ595C2.2
Gene description: angiopoietin-like 1
Genbank accession: BC050640
Immunogen: ANGPTL1 (AAH50640, 24 a.a. ~ 491 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPID
Protein accession: AAH50640
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009068-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ANGPTL1 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ANGPTL1 monoclonal antibody (M01), clone 1C2 now

Add to cart