SYT7 monoclonal antibody (M01), clone 4H4 View larger

SYT7 monoclonal antibody (M01), clone 4H4

H00009066-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYT7 monoclonal antibody (M01), clone 4H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SYT7 monoclonal antibody (M01), clone 4H4

Brand: Abnova
Reference: H00009066-M01
Product name: SYT7 monoclonal antibody (M01), clone 4H4
Product description: Mouse monoclonal antibody raised against a partial recombinant SYT7.
Clone: 4H4
Isotype: IgG2a Kappa
Gene id: 9066
Gene name: SYT7
Gene alias: IPCA-7|MGC150517|PCANAP7|SYT-VII
Gene description: synaptotagmin VII
Genbank accession: NM_004200
Immunogen: SYT7 (NP_004191.2, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRI
Protein accession: NP_004191.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009066-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009066-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SYT7 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SYT7 monoclonal antibody (M01), clone 4H4 now

Add to cart