MAP3K6 polyclonal antibody (A01) View larger

MAP3K6 polyclonal antibody (A01)

H00009064-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP3K6 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MAP3K6 polyclonal antibody (A01)

Brand: Abnova
Reference: H00009064-A01
Product name: MAP3K6 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MAP3K6.
Gene id: 9064
Gene name: MAP3K6
Gene alias: ASK2|MAPKKK6|MGC125653|MGC20114
Gene description: mitogen-activated protein kinase kinase kinase 6
Genbank accession: BC015914
Immunogen: MAP3K6 (AAH15914, 225 a.a. ~ 325 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEPETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLC
Protein accession: AAH15914
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009064-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Mitogen-Activated Protein 3 Kinase 6 Mediates Angiogenic and Tumorigenic Effects via Vascular Endothelial Growth Factor Expression.Eto N, Miyagishi M, Inagi R, Fujita T, Nangaku M.
Am J Pathol. 2009 Apr;174(4):1553-63. Epub 2009 Feb 26.

Reviews

Buy MAP3K6 polyclonal antibody (A01) now

Add to cart