Brand: | Abnova |
Reference: | H00009063-M01 |
Product name: | PIAS2 monoclonal antibody (M01), clone 1F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIAS2. |
Clone: | 1F7 |
Isotype: | IgG2a Kappa |
Gene id: | 9063 |
Gene name: | PIAS2 |
Gene alias: | MGC102682|MIZ1|PIASX|PIASX-ALPHA|PIASX-BETA|SIZ2|ZMIZ4|miz |
Gene description: | protein inhibitor of activated STAT, 2 |
Genbank accession: | NM_004671 |
Immunogen: | PIAS2 (NP_004662, 385 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLT |
Protein accession: | NP_004662 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Western blot analysis of PIAS2 over-expressed 293 cell line, cotransfected with PIAS2 Validated Chimera RNAi ( Cat # H00009063-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS2 monoclonal antibody (M01), clone 1F7 (Cat # H00009063-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | IF,S-ELISA,ELISA,WB-Re,RNAi-Ab,PLA-Ce |
Shipping condition: | Dry Ice |