PIAS2 monoclonal antibody (M01), clone 1F7 View larger

PIAS2 monoclonal antibody (M01), clone 1F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIAS2 monoclonal antibody (M01), clone 1F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,RNAi-Ab,PLA-Ce

More info about PIAS2 monoclonal antibody (M01), clone 1F7

Brand: Abnova
Reference: H00009063-M01
Product name: PIAS2 monoclonal antibody (M01), clone 1F7
Product description: Mouse monoclonal antibody raised against a partial recombinant PIAS2.
Clone: 1F7
Isotype: IgG2a Kappa
Gene id: 9063
Gene name: PIAS2
Gene alias: MGC102682|MIZ1|PIASX|PIASX-ALPHA|PIASX-BETA|SIZ2|ZMIZ4|miz
Gene description: protein inhibitor of activated STAT, 2
Genbank accession: NM_004671
Immunogen: PIAS2 (NP_004662, 385 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLT
Protein accession: NP_004662
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009063-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009063-M01-42-R01V-1.jpg
Application image note: Western blot analysis of PIAS2 over-expressed 293 cell line, cotransfected with PIAS2 Validated Chimera RNAi ( Cat # H00009063-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS2 monoclonal antibody (M01), clone 1F7 (Cat # H00009063-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: IF,S-ELISA,ELISA,WB-Re,RNAi-Ab,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy PIAS2 monoclonal antibody (M01), clone 1F7 now

Add to cart