Brand: | Abnova |
Reference: | H00009061-M05 |
Product name: | PAPSS1 monoclonal antibody (M05), clone 1F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PAPSS1. |
Clone: | 1F4 |
Isotype: | IgG2a Kappa |
Gene id: | 9061 |
Gene name: | PAPSS1 |
Gene alias: | ATPSK1|PAPSS|SK1 |
Gene description: | 3'-phosphoadenosine 5'-phosphosulfate synthase 1 |
Genbank accession: | NM_005443 |
Immunogen: | PAPSS1 (NP_005434, 144 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAE |
Protein accession: | NP_005434 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Western blot analysis of PAPSS1 over-expressed 293 cell line, cotransfected with PAPSS1 Validated Chimera RNAi ( Cat # H00009061-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS1 monoclonal antibody (M05), clone 1F4 (Cat # H00009061-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |