PAPSS1 monoclonal antibody (M05), clone 1F4 View larger

PAPSS1 monoclonal antibody (M05), clone 1F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAPSS1 monoclonal antibody (M05), clone 1F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about PAPSS1 monoclonal antibody (M05), clone 1F4

Brand: Abnova
Reference: H00009061-M05
Product name: PAPSS1 monoclonal antibody (M05), clone 1F4
Product description: Mouse monoclonal antibody raised against a partial recombinant PAPSS1.
Clone: 1F4
Isotype: IgG2a Kappa
Gene id: 9061
Gene name: PAPSS1
Gene alias: ATPSK1|PAPSS|SK1
Gene description: 3'-phosphoadenosine 5'-phosphosulfate synthase 1
Genbank accession: NM_005443
Immunogen: PAPSS1 (NP_005434, 144 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAE
Protein accession: NP_005434
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009061-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009061-M05-42-R01V-1.jpg
Application image note: Western blot analysis of PAPSS1 over-expressed 293 cell line, cotransfected with PAPSS1 Validated Chimera RNAi ( Cat # H00009061-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PAPSS1 monoclonal antibody (M05), clone 1F4 (Cat # H00009061-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: IF,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy PAPSS1 monoclonal antibody (M05), clone 1F4 now

Add to cart