PAPSS2 monoclonal antibody (M07), clone 2A8 View larger

PAPSS2 monoclonal antibody (M07), clone 2A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAPSS2 monoclonal antibody (M07), clone 2A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about PAPSS2 monoclonal antibody (M07), clone 2A8

Brand: Abnova
Reference: H00009060-M07
Product name: PAPSS2 monoclonal antibody (M07), clone 2A8
Product description: Mouse monoclonal antibody raised against a partial recombinant PAPSS2.
Clone: 2A8
Isotype: IgG1 Kappa
Gene id: 9060
Gene name: PAPSS2
Gene alias: ATPSK2|SK2
Gene description: 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Genbank accession: NM_004670
Immunogen: PAPSS2 (NP_004661, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE
Protein accession: NP_004661
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009060-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00009060-M07-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: PAPSS2 Promotes Alkaline Phosphates Activity and Mineralization of Osteoblastic MC3T3-E1 Cells by Crosstalk and Smads Signal Pathways.Wang W, Li F, Wang K, Cheng B, Guo X.
PLoS One. 2012;7(8):e43475. Epub 2012 Aug 16.

Reviews

Buy PAPSS2 monoclonal antibody (M07), clone 2A8 now

Add to cart