Brand: | Abnova |
Reference: | H00009060-M07 |
Product name: | PAPSS2 monoclonal antibody (M07), clone 2A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PAPSS2. |
Clone: | 2A8 |
Isotype: | IgG1 Kappa |
Gene id: | 9060 |
Gene name: | PAPSS2 |
Gene alias: | ATPSK2|SK2 |
Gene description: | 3'-phosphoadenosine 5'-phosphosulfate synthase 2 |
Genbank accession: | NM_004670 |
Immunogen: | PAPSS2 (NP_004661, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLE |
Protein accession: | NP_004661 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PAPSS2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | PAPSS2 Promotes Alkaline Phosphates Activity and Mineralization of Osteoblastic MC3T3-E1 Cells by Crosstalk and Smads Signal Pathways.Wang W, Li F, Wang K, Cheng B, Guo X. PLoS One. 2012;7(8):e43475. Epub 2012 Aug 16. |