SLC7A7 monoclonal antibody (M04), clone 3B10 View larger

SLC7A7 monoclonal antibody (M04), clone 3B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC7A7 monoclonal antibody (M04), clone 3B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SLC7A7 monoclonal antibody (M04), clone 3B10

Brand: Abnova
Reference: H00009056-M04
Product name: SLC7A7 monoclonal antibody (M04), clone 3B10
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC7A7.
Clone: 3B10
Isotype: IgG2b Kappa
Gene id: 9056
Gene name: SLC7A7
Gene alias: LAT3|LPI|MOP-2|Y+LAT1|y+LAT-1
Gene description: solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
Genbank accession: NM_003982
Immunogen: SLC7A7 (NP_003973.2, 462 a.a. ~ 511 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Protein accession: NP_003973.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009056-M04-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC7A7 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SLC7A7 monoclonal antibody (M04), clone 3B10 now

Add to cart