Brand: | Abnova |
Reference: | H00009056-M04 |
Product name: | SLC7A7 monoclonal antibody (M04), clone 3B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC7A7. |
Clone: | 3B10 |
Isotype: | IgG2b Kappa |
Gene id: | 9056 |
Gene name: | SLC7A7 |
Gene alias: | LAT3|LPI|MOP-2|Y+LAT1|y+LAT-1 |
Gene description: | solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 |
Genbank accession: | NM_003982 |
Immunogen: | SLC7A7 (NP_003973.2, 462 a.a. ~ 511 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN |
Protein accession: | NP_003973.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC7A7 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |