AIP monoclonal antibody (M02), clone 3D3 View larger

AIP monoclonal antibody (M02), clone 3D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AIP monoclonal antibody (M02), clone 3D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about AIP monoclonal antibody (M02), clone 3D3

Brand: Abnova
Reference: H00009049-M02
Product name: AIP monoclonal antibody (M02), clone 3D3
Product description: Mouse monoclonal antibody raised against a partial recombinant AIP.
Clone: 3D3
Isotype: IgG1 Kappa
Gene id: 9049
Gene name: AIP
Gene alias: ARA9|FKBP16|FKBP37|SMTPHN|XAP2
Gene description: aryl hydrocarbon receptor interacting protein
Genbank accession: NM_003977
Immunogen: AIP (NP_003968.1, 156 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE
Protein accession: NP_003968.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009049-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009049-M02-1-12-1.jpg
Application image note: AIP monoclonal antibody (M02), clone 3D3. Western Blot analysis of AIP expression in HepG2(Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AIP monoclonal antibody (M02), clone 3D3 now

Add to cart