Brand: | Abnova |
Reference: | H00009049-M02 |
Product name: | AIP monoclonal antibody (M02), clone 3D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AIP. |
Clone: | 3D3 |
Isotype: | IgG1 Kappa |
Gene id: | 9049 |
Gene name: | AIP |
Gene alias: | ARA9|FKBP16|FKBP37|SMTPHN|XAP2 |
Gene description: | aryl hydrocarbon receptor interacting protein |
Genbank accession: | NM_003977 |
Immunogen: | AIP (NP_003968.1, 156 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE |
Protein accession: | NP_003968.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | AIP monoclonal antibody (M02), clone 3D3. Western Blot analysis of AIP expression in HepG2(Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |