RPL14 monoclonal antibody (M01), clone 1B4 View larger

RPL14 monoclonal antibody (M01), clone 1B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPL14 monoclonal antibody (M01), clone 1B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about RPL14 monoclonal antibody (M01), clone 1B4

Brand: Abnova
Reference: H00009045-M01
Product name: RPL14 monoclonal antibody (M01), clone 1B4
Product description: Mouse monoclonal antibody raised against a partial recombinant RPL14.
Clone: 1B4
Isotype: IgG2a Kappa
Gene id: 9045
Gene name: RPL14
Gene alias: CAG-ISL-7|CTG-B33|L14|MGC88594|RL14|hRL14
Gene description: ribosomal protein L14
Genbank accession: NM_003973
Immunogen: RPL14 (NP_003964, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATR
Protein accession: NP_003964
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009045-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009045-M01-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RPL14 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RPL14 monoclonal antibody (M01), clone 1B4 now

Add to cart