UBE2M monoclonal antibody (M02), clone 1G9 View larger

UBE2M monoclonal antibody (M02), clone 1G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2M monoclonal antibody (M02), clone 1G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about UBE2M monoclonal antibody (M02), clone 1G9

Brand: Abnova
Reference: H00009040-M02
Product name: UBE2M monoclonal antibody (M02), clone 1G9
Product description: Mouse monoclonal antibody raised against a full-length recombinant UBE2M.
Clone: 1G9
Isotype: IgG1 Kappa
Gene id: 9040
Gene name: UBE2M
Gene alias: UBC-RS2|UBC12|hUbc12
Gene description: ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
Genbank accession: BC058924
Immunogen: UBE2M (AAH58924, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Protein accession: AAH58924
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009040-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009040-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged UBE2M is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UBE2M monoclonal antibody (M02), clone 1G9 now

Add to cart