UBE2M monoclonal antibody (M01), clone 3C4 View larger

UBE2M monoclonal antibody (M01), clone 3C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2M monoclonal antibody (M01), clone 3C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about UBE2M monoclonal antibody (M01), clone 3C4

Brand: Abnova
Reference: H00009040-M01
Product name: UBE2M monoclonal antibody (M01), clone 3C4
Product description: Mouse monoclonal antibody raised against a full length recombinant UBE2M.
Clone: 3C4
Isotype: IgG1 kappa
Gene id: 9040
Gene name: UBE2M
Gene alias: UBC-RS2|UBC12|hUbc12
Gene description: ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
Genbank accession: BC058924
Immunogen: UBE2M (AAH58924, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Protein accession: AAH58924
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009040-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009040-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to UBE2M on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Application of an integrated physical and functional screening approach to identify inhibitors of the Wnt pathway.Miller BW, Lau G, Grouios C, Mollica E, Barrios-Rodiles M, Liu Y, Datti A, Morris Q, Wrana JL, Attisano L.
Molecular Systems Biology 5; Article number 315; doi:10.1038 /msb.2009.72

Reviews

Buy UBE2M monoclonal antibody (M01), clone 3C4 now

Add to cart