Brand: | Abnova |
Reference: | H00009037-A01 |
Product name: | SEMA5A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SEMA5A. |
Gene id: | 9037 |
Gene name: | SEMA5A |
Gene alias: | FLJ12815|SEMAF|semF |
Gene description: | sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A |
Genbank accession: | NM_003966 |
Immunogen: | SEMA5A (NP_003957, 393 a.a. ~ 499 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGA |
Protein accession: | NP_003957 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.88 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |