Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00009034-D01P |
Product name: | CCRL2 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CCRL2 protein. |
Gene id: | 9034 |
Gene name: | CCRL2 |
Gene alias: | CKRX|CRAM-A|CRAM-B|FLJ55815|HCR|MGC116710 |
Gene description: | chemokine (C-C motif) receptor-like 2 |
Genbank accession: | NM_003965.4 |
Immunogen: | CCRL2 (NP_003956.2, 1 a.a. ~ 344 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV |
Protein accession: | NP_003956.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CCRL2 expression in transfected 293T cell line (H00009034-T04) by CCRL2 MaxPab polyclonal antibody. Lane 1: CCRL2 transfected lysate(39.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |