PKD2L1 monoclonal antibody (M01), clone 4F9 View larger

PKD2L1 monoclonal antibody (M01), clone 4F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PKD2L1 monoclonal antibody (M01), clone 4F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about PKD2L1 monoclonal antibody (M01), clone 4F9

Brand: Abnova
Reference: H00009033-M01
Product name: PKD2L1 monoclonal antibody (M01), clone 4F9
Product description: Mouse monoclonal antibody raised against a partial recombinant PKD2L1.
Clone: 4F9
Isotype: IgG2b Kappa
Gene id: 9033
Gene name: PKD2L1
Gene alias: PCL|PKD2L|PKDL
Gene description: polycystic kidney disease 2-like 1
Genbank accession: NM_016112
Immunogen: PKD2L1 (NP_057196.2, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYL
Protein accession: NP_057196.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009033-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00009033-M01-2-D1-1.jpg
Application image note: PKD2L1 monoclonal antibody (M01), clone 4F9. Western Blot analysis of PKD2L1 expression in rat brain.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: A novel PKD2L1 C-terminal domain critical for trimerization and channel function.Zheng W, Hussein S, Yang J, Huang J, Zhang F, Hernandez-Anzaldo S, Fernandez-Patron C, Cao Y, Zeng H, Tang J, Chen XZ
Sci Rep. 2015 Mar 30;5:9460. doi: 10.1038/srep09460.

Reviews

Buy PKD2L1 monoclonal antibody (M01), clone 4F9 now

Add to cart