BAZ1B monoclonal antibody (M01A), clone 5E9 View larger

BAZ1B monoclonal antibody (M01A), clone 5E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BAZ1B monoclonal antibody (M01A), clone 5E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about BAZ1B monoclonal antibody (M01A), clone 5E9

Brand: Abnova
Reference: H00009031-M01A
Product name: BAZ1B monoclonal antibody (M01A), clone 5E9
Product description: Mouse monoclonal antibody raised against a partial recombinant BAZ1B.
Clone: 5E9
Isotype: IgG2a Kappa
Gene id: 9031
Gene name: BAZ1B
Gene alias: WBSCR10|WBSCR9|WSTF
Gene description: bromodomain adjacent to zinc finger domain, 1B
Genbank accession: NM_023005
Immunogen: BAZ1B (NP_075381, 1384 a.a. ~ 1483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK
Protein accession: NP_075381
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy BAZ1B monoclonal antibody (M01A), clone 5E9 now

Add to cart