Brand: | Abnova |
Reference: | H00009031-M01A |
Product name: | BAZ1B monoclonal antibody (M01A), clone 5E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BAZ1B. |
Clone: | 5E9 |
Isotype: | IgG2a Kappa |
Gene id: | 9031 |
Gene name: | BAZ1B |
Gene alias: | WBSCR10|WBSCR9|WSTF |
Gene description: | bromodomain adjacent to zinc finger domain, 1B |
Genbank accession: | NM_023005 |
Immunogen: | BAZ1B (NP_075381, 1384 a.a. ~ 1483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK |
Protein accession: | NP_075381 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |