BAZ1B monoclonal antibody (M01), clone 5E9 View larger

BAZ1B monoclonal antibody (M01), clone 5E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BAZ1B monoclonal antibody (M01), clone 5E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,PLA-Ce

More info about BAZ1B monoclonal antibody (M01), clone 5E9

Brand: Abnova
Reference: H00009031-M01
Product name: BAZ1B monoclonal antibody (M01), clone 5E9
Product description: Mouse monoclonal antibody raised against a partial recombinant BAZ1B.
Clone: 5E9
Isotype: IgG2a Kappa
Gene id: 9031
Gene name: BAZ1B
Gene alias: WBSCR10|WBSCR9|WSTF
Gene description: bromodomain adjacent to zinc finger domain, 1B
Genbank accession: NM_023005
Immunogen: BAZ1B (NP_075381, 1384 a.a. ~ 1483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK
Protein accession: NP_075381
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009031-M01-3-8-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to BAZ1B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy BAZ1B monoclonal antibody (M01), clone 5E9 now

Add to cart