HIP1R monoclonal antibody (M01A), clone 3E10 View larger

HIP1R monoclonal antibody (M01A), clone 3E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIP1R monoclonal antibody (M01A), clone 3E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re

More info about HIP1R monoclonal antibody (M01A), clone 3E10

Brand: Abnova
Reference: H00009026-M01A
Product name: HIP1R monoclonal antibody (M01A), clone 3E10
Product description: Mouse monoclonal antibody raised against a partial recombinant HIP1R.
Clone: 3E10
Isotype: IgG1 Kappa
Gene id: 9026
Gene name: HIP1R
Gene alias: FLJ14000|FLJ27022|HIP12|HIP3|ILWEQ|KIAA0655|MGC47513
Gene description: huntingtin interacting protein 1 related
Genbank accession: NM_003959
Immunogen: HIP1R (NP_003950, 969 a.a. ~ 1066 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQDHQLDKKDGIYPAQLV
Protein accession: NP_003950
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009026-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009026-M01A-1-4-1.jpg
Application image note: HIP1R monoclonal antibody (M01A), clone 3E10 Western Blot analysis of HIP1R expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HIP1R monoclonal antibody (M01A), clone 3E10 now

Add to cart