Brand: | Abnova |
Reference: | H00009026-M01A |
Product name: | HIP1R monoclonal antibody (M01A), clone 3E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HIP1R. |
Clone: | 3E10 |
Isotype: | IgG1 Kappa |
Gene id: | 9026 |
Gene name: | HIP1R |
Gene alias: | FLJ14000|FLJ27022|HIP12|HIP3|ILWEQ|KIAA0655|MGC47513 |
Gene description: | huntingtin interacting protein 1 related |
Genbank accession: | NM_003959 |
Immunogen: | HIP1R (NP_003950, 969 a.a. ~ 1066 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQDHQLDKKDGIYPAQLV |
Protein accession: | NP_003950 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HIP1R monoclonal antibody (M01A), clone 3E10 Western Blot analysis of HIP1R expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |