RNF8 purified MaxPab mouse polyclonal antibody (B01P) View larger

RNF8 purified MaxPab mouse polyclonal antibody (B01P)

H00009025-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF8 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about RNF8 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009025-B01P
Product name: RNF8 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RNF8 protein.
Gene id: 9025
Gene name: RNF8
Gene alias: FLJ12013|KIAA0646
Gene description: ring finger protein 8
Genbank accession: NM_003958.2
Immunogen: RNF8 (NP_003949.1, 1 a.a. ~ 485 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF
Protein accession: NP_003949.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009025-B01P-13-15-1.jpg
Application image note: Western Blot analysis of RNF8 expression in transfected 293T cell line (H00009025-T02) by RNF8 MaxPab polyclonal antibody.

Lane 1: RNF8 transfected lysate(53.35 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice
Publications: Epstein-Barr virus BZLF1 protein impairs accumulation of host DNA damage proteins at damage sites in response to DNA damage.Yang J, Deng W, Hau PM, Liu J, Lau VM, Cheung AL, Huen MS, Tsao SW.
Lab Invest. 2015 Jun 1. [Epub ahead of print]

Reviews

Buy RNF8 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart