CH25H monoclonal antibody (M01), clone 1G8 View larger

CH25H monoclonal antibody (M01), clone 1G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CH25H monoclonal antibody (M01), clone 1G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CH25H monoclonal antibody (M01), clone 1G8

Brand: Abnova
Reference: H00009023-M01
Product name: CH25H monoclonal antibody (M01), clone 1G8
Product description: Mouse monoclonal antibody raised against a partial recombinant CH25H.
Clone: 1G8
Isotype: IgG2b Kappa
Gene id: 9023
Gene name: CH25H
Gene alias: C25H
Gene description: cholesterol 25-hydroxylase
Genbank accession: BC017843
Immunogen: CH25H (AAH17843.1, 142 a.a. ~ 247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFN
Protein accession: AAH17843.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009023-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CH25H monoclonal antibody (M01), clone 1G8 now

Add to cart