Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CH25H polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CH25H polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009023-A01 |
| Product name: | CH25H polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CH25H. |
| Gene id: | 9023 |
| Gene name: | CH25H |
| Gene alias: | C25H |
| Gene description: | cholesterol 25-hydroxylase |
| Genbank accession: | NM_003956 |
| Immunogen: | CH25H (NP_003947, 206 a.a. ~ 272 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR |
| Protein accession: | NP_003947 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.48 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Increased 25-hydroxycholesterol concentrations in the lungs of patients with chronic obstructive pulmonary disease.Sugiura H, Koarai A, Ichikawa T, Minakata Y, Matsunaga K, Hirano T, Akamatsu K, Yanagisawa S, Furusawa M, Uno Y, Yamasaki M, Satomi Y, Ichinose M. Respirology. 2012 Feb 1. doi: 10.1111/j.1440-1843.2012.02136.x. [Epub ahead of print] |