CLIC3 monoclonal antibody (M04), clone 2C5 View larger

CLIC3 monoclonal antibody (M04), clone 2C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLIC3 monoclonal antibody (M04), clone 2C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CLIC3 monoclonal antibody (M04), clone 2C5

Brand: Abnova
Reference: H00009022-M04
Product name: CLIC3 monoclonal antibody (M04), clone 2C5
Product description: Mouse monoclonal antibody raised against a partial recombinant CLIC3.
Clone: 2C5
Isotype: IgG1 Kappa
Gene id: 9022
Gene name: CLIC3
Gene alias: -
Gene description: chloride intracellular channel 3
Genbank accession: NM_004669
Immunogen: CLIC3 (NP_004660, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Protein accession: NP_004660
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009022-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009022-M04-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged CLIC3 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CLIC3 monoclonal antibody (M04), clone 2C5 now

Add to cart