CLIC3 MaxPab rabbit polyclonal antibody (D01) View larger

CLIC3 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLIC3 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr,IP

More info about CLIC3 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00009022-D01
Product name: CLIC3 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human CLIC3 protein.
Gene id: 9022
Gene name: CLIC3
Gene alias: -
Gene description: chloride intracellular channel 3
Genbank accession: NM_004669.2
Immunogen: CLIC3 (NP_004660.2, 1 a.a. ~ 236 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Protein accession: NP_004660.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00009022-D01-2-A8-1.jpg
Application image note: CLIC3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CLIC3 expression in human placenta.
Applications: WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CLIC3 MaxPab rabbit polyclonal antibody (D01) now

Add to cart