Brand: | Abnova |
Reference: | H00009021-M05 |
Product name: | SOCS3 monoclonal antibody (M05), clone 2H2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SOCS3. |
Clone: | 2H2 |
Isotype: | IgG2b Kappa |
Gene id: | 9021 |
Gene name: | SOCS3 |
Gene alias: | ATOD4|CIS3|Cish3|MGC71791|SOCS-3|SSI-3|SSI3 |
Gene description: | suppressor of cytokine signaling 3 |
Genbank accession: | BC060858 |
Immunogen: | SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
Protein accession: | AAH60858 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SOCS3 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |