SOCS3 monoclonal antibody (M02), clone 1E4 View larger

SOCS3 monoclonal antibody (M02), clone 1E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOCS3 monoclonal antibody (M02), clone 1E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA

More info about SOCS3 monoclonal antibody (M02), clone 1E4

Brand: Abnova
Reference: H00009021-M02
Product name: SOCS3 monoclonal antibody (M02), clone 1E4
Product description: Mouse monoclonal antibody raised against a full length recombinant SOCS3.
Clone: 1E4
Isotype: IgG2b Kappa
Gene id: 9021
Gene name: SOCS3
Gene alias: ATOD4|CIS3|Cish3|MGC71791|SOCS-3|SSI-3|SSI3
Gene description: suppressor of cytokine signaling 3
Genbank accession: BC060858
Immunogen: SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Protein accession: AAH60858
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009021-M02-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SOCS3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: Epigenetic silencing of SOCS3 identifies a subset of prostate cancer with an aggressive behavior.Pierconti F, Martini M, Pinto F, Cenci T, Capodimonti S, Calarco A, Bassi PF, Larocca LM.
Prostate. 2010 Aug 17. [Epub ahead of print]

Reviews

Buy SOCS3 monoclonal antibody (M02), clone 1E4 now

Add to cart