SOCS3 monoclonal antibody (M01), clone 2E5 View larger

SOCS3 monoclonal antibody (M01), clone 2E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOCS3 monoclonal antibody (M01), clone 2E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SOCS3 monoclonal antibody (M01), clone 2E5

Brand: Abnova
Reference: H00009021-M01
Product name: SOCS3 monoclonal antibody (M01), clone 2E5
Product description: Mouse monoclonal antibody raised against a full-length recombinant SOCS3.
Clone: 2E5
Isotype: IgG2a Kappa
Gene id: 9021
Gene name: SOCS3
Gene alias: ATOD4|CIS3|Cish3|MGC71791|SOCS-3|SSI-3|SSI3
Gene description: suppressor of cytokine signaling 3
Genbank accession: BC060858
Immunogen: SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Protein accession: AAH60858
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009021-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SOCS3 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SOCS3 monoclonal antibody (M01), clone 2E5 now

Add to cart