Brand: | Abnova |
Reference: | H00009016-M01 |
Product name: | SLC25A14 monoclonal antibody (M01), clone 1C12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SLC25A14. |
Clone: | 1C12 |
Isotype: | IgG1 Kappa |
Gene id: | 9016 |
Gene name: | SLC25A14 |
Gene alias: | BMCP1|MGC149543|UCP5 |
Gene description: | solute carrier family 25 (mitochondrial carrier, brain), member 14 |
Genbank accession: | NM_003951.2 |
Immunogen: | SLC25A14 (NP_003942.1, 1 a.a. ~ 325 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI |
Protein accession: | NP_003942.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |