CDKL2 monoclonal antibody (M01), clone 1F6 View larger

CDKL2 monoclonal antibody (M01), clone 1F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDKL2 monoclonal antibody (M01), clone 1F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about CDKL2 monoclonal antibody (M01), clone 1F6

Brand: Abnova
Reference: H00008999-M01
Product name: CDKL2 monoclonal antibody (M01), clone 1F6
Product description: Mouse monoclonal antibody raised against a partial recombinant CDKL2.
Clone: 1F6
Isotype: IgG1 Kappa
Gene id: 8999
Gene name: CDKL2
Gene alias: KKIAMRE|P56
Gene description: cyclin-dependent kinase-like 2 (CDC2-related kinase)
Genbank accession: NM_003948
Immunogen: CDKL2 (NP_003939, 394 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LKDCSNVSVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH
Protein accession: NP_003939
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008999-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008999-M01-3-51-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CDKL2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 0.7 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDKL2 monoclonal antibody (M01), clone 1F6 now

Add to cart