NOL3 monoclonal antibody (M03A), clone 6F5 View larger

NOL3 monoclonal antibody (M03A), clone 6F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NOL3 monoclonal antibody (M03A), clone 6F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about NOL3 monoclonal antibody (M03A), clone 6F5

Brand: Abnova
Reference: H00008996-M03A
Product name: NOL3 monoclonal antibody (M03A), clone 6F5
Product description: Mouse monoclonal antibody raised against a full-length recombinant NOL3.
Clone: 6F5
Isotype: IgG2a Kappa
Gene id: 8996
Gene name: NOL3
Gene alias: ARC|CARD2|MYC|MYP|NOP|NOP30
Gene description: nucleolar protein 3 (apoptosis repressor with CARD domain)
Genbank accession: NM_003946.3
Immunogen: NOL3 (NP_003937.1, 1 a.a. ~ 208 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Protein accession: NP_003937.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008996-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008996-M03A-13-15-1.jpg
Application image note: Western Blot analysis of NOL3 expression in transfected 293T cell line by NOL3 monoclonal antibody (M03A), clone 6F5.

Lane 1: NOL3 transfected lysate (Predicted MW: 22.6 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NOL3 monoclonal antibody (M03A), clone 6F5 now

Add to cart