TNFSF18 monoclonal antibody (M28), clone 3F6 View larger

TNFSF18 monoclonal antibody (M28), clone 3F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF18 monoclonal antibody (M28), clone 3F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TNFSF18 monoclonal antibody (M28), clone 3F6

Brand: Abnova
Reference: H00008995-M28
Product name: TNFSF18 monoclonal antibody (M28), clone 3F6
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFSF18.
Clone: 3F6
Isotype: IgG1 Kappa
Gene id: 8995
Gene name: TNFSF18
Gene alias: AITRL|GITRL|MGC138237|TL6|hGITRL
Gene description: tumor necrosis factor (ligand) superfamily, member 18
Genbank accession: BC069111.1
Immunogen: TNFSF18 (AAH69111.1, 50 a.a. ~ 177 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Protein accession: AAH69111.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TNFSF18 monoclonal antibody (M28), clone 3F6 now

Add to cart