TNFSF18 monoclonal antibody (M20), clone 4D10 View larger

TNFSF18 monoclonal antibody (M20), clone 4D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF18 monoclonal antibody (M20), clone 4D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TNFSF18 monoclonal antibody (M20), clone 4D10

Brand: Abnova
Reference: H00008995-M20
Product name: TNFSF18 monoclonal antibody (M20), clone 4D10
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFSF18.
Clone: 4D10
Isotype: IgG1 Kappa
Gene id: 8995
Gene name: TNFSF18
Gene alias: AITRL|GITRL|MGC138237|TL6|hGITRL
Gene description: tumor necrosis factor (ligand) superfamily, member 18
Genbank accession: BC069111.1
Immunogen: TNFSF18 (AAH69111.1, 50 a.a. ~ 177 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Protein accession: AAH69111.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008995-M20-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (16.28 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNFSF18 monoclonal antibody (M20), clone 4D10 now

Add to cart