Brand: | Abnova |
Reference: | H00008995-M01 |
Product name: | TNFSF18 monoclonal antibody (M01), clone 6F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF18. |
Clone: | 6F7 |
Isotype: | IgG2a Kappa |
Gene id: | 8995 |
Gene name: | TNFSF18 |
Gene alias: | AITRL|GITRL|MGC138237|TL6|hGITRL |
Gene description: | tumor necrosis factor (ligand) superfamily, member 18 |
Genbank accession: | NM_005092 |
Immunogen: | TNFSF18 (NP_005083, 68 a.a. ~ 177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
Protein accession: | NP_005083 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TNFSF18 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |