TNFSF18 monoclonal antibody (M01), clone 6F7 View larger

TNFSF18 monoclonal antibody (M01), clone 6F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF18 monoclonal antibody (M01), clone 6F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TNFSF18 monoclonal antibody (M01), clone 6F7

Brand: Abnova
Reference: H00008995-M01
Product name: TNFSF18 monoclonal antibody (M01), clone 6F7
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFSF18.
Clone: 6F7
Isotype: IgG2a Kappa
Gene id: 8995
Gene name: TNFSF18
Gene alias: AITRL|GITRL|MGC138237|TL6|hGITRL
Gene description: tumor necrosis factor (ligand) superfamily, member 18
Genbank accession: NM_005092
Immunogen: TNFSF18 (NP_005083, 68 a.a. ~ 177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Protein accession: NP_005083
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008995-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008995-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TNFSF18 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNFSF18 monoclonal antibody (M01), clone 6F7 now

Add to cart