LIMD1 monoclonal antibody (M01), clone 2G5 View larger

LIMD1 monoclonal antibody (M01), clone 2G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LIMD1 monoclonal antibody (M01), clone 2G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about LIMD1 monoclonal antibody (M01), clone 2G5

Brand: Abnova
Reference: H00008994-M01
Product name: LIMD1 monoclonal antibody (M01), clone 2G5
Product description: Mouse monoclonal antibody raised against a partial recombinant LIMD1.
Clone: 2G5
Isotype: IgG2b Kappa
Gene id: 8994
Gene name: LIMD1
Gene alias: -
Gene description: LIM domains containing 1
Genbank accession: NM_014240
Immunogen: LIMD1 (NP_055055.1, 577 a.a. ~ 674 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEKRPSSTALHQH
Protein accession: NP_055055.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008994-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008994-M01-3-38-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to LIMD1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LIMD1 monoclonal antibody (M01), clone 2G5 now

Add to cart