Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRPA1 monoclonal antibody (M03), clone 6G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about TRPA1 monoclonal antibody (M03), clone 6G8
| Brand: | Abnova |
| Reference: | H00008989-M03 |
| Product name: | TRPA1 monoclonal antibody (M03), clone 6G8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRPA1. |
| Clone: | 6G8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8989 |
| Gene name: | TRPA1 |
| Gene alias: | ANKTM1 |
| Gene description: | transient receptor potential cation channel, subfamily A, member 1 |
| Genbank accession: | NM_007332 |
| Immunogen: | TRPA1 (NP_015628, 1033 a.a. ~ 1117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL |
| Protein accession: | NP_015628 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged TRPA1 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Transient receptor potential ankyrin 1 channel involved in atherosclerosis and macrophage-foam cell formation.Zhao JF, Shyue SK, Kou YR, Lu TS, Lee TS. Int J Biol Sci 2016; 12(7):812-823. |