Brand: | Abnova |
Reference: | H00008987-M11 |
Product name: | GENX-3414 monoclonal antibody (M11), clone 2C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GENX-3414. |
Clone: | 2C10 |
Isotype: | IgG1 Kappa |
Gene id: | 8987 |
Gene name: | STBD1 |
Gene alias: | FLJ41801|GENEX3414|GENX-3414 |
Gene description: | starch binding domain 1 |
Genbank accession: | NM_003943 |
Immunogen: | GENX-3414 (NP_003934, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDH* |
Protein accession: | NP_003934 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008987-M11-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008987-M11-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged GENX-3414 is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |