GENX-3414 monoclonal antibody (M11), clone 2C10 View larger

GENX-3414 monoclonal antibody (M11), clone 2C10

H00008987-M11_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GENX-3414 monoclonal antibody (M11), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GENX-3414 monoclonal antibody (M11), clone 2C10

Brand: Abnova
Reference: H00008987-M11
Product name: GENX-3414 monoclonal antibody (M11), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant GENX-3414.
Clone: 2C10
Isotype: IgG1 Kappa
Gene id: 8987
Gene name: STBD1
Gene alias: FLJ41801|GENEX3414|GENX-3414
Gene description: starch binding domain 1
Genbank accession: NM_003943
Immunogen: GENX-3414 (NP_003934, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDH*
Protein accession: NP_003934
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008987-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged GENX-3414 is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GENX-3414 monoclonal antibody (M11), clone 2C10 now

Add to cart