Brand: | Abnova |
Reference: | H00008976-M04 |
Product name: | WASL monoclonal antibody (M04), clone 5F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant WASL. |
Clone: | 5F4 |
Isotype: | IgG2b Kappa |
Gene id: | 8976 |
Gene name: | WASL |
Gene alias: | DKFZp779G0847|MGC48327|N-WASP|NWASP |
Gene description: | Wiskott-Aldrich syndrome-like |
Genbank accession: | NM_003941 |
Immunogen: | WASL (NP_003932, 97 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISH |
Protein accession: | NP_003932 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to WASL on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |