H1FX (Human) Recombinant Protein (P01) View larger

H1FX (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of H1FX (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about H1FX (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00008971-P01
Product name: H1FX (Human) Recombinant Protein (P01)
Product description: Human H1FX full-length ORF ( NP_006017.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8971
Gene name: H1FX
Gene alias: H1X|MGC15959|MGC8350
Gene description: H1 histone family, member X
Genbank accession: NM_006026.2
Immunogen sequence/protein sequence: MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
Protein accession: NP_006017.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00008971-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy H1FX (Human) Recombinant Protein (P01) now

Add to cart