Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00008971-B01P |
Product name: | H1FX purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human H1FX protein. |
Gene id: | 8971 |
Gene name: | H1FX |
Gene alias: | H1X|MGC15959|MGC8350 |
Gene description: | H1 histone family, member X |
Genbank accession: | NM_006026 |
Immunogen: | H1FX (NP_006017.1, 1 a.a. ~ 213 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK |
Protein accession: | NP_006017.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of H1FX expression in transfected 293T cell line (H00008971-T02) by H1FX MaxPab polyclonal antibody. Lane 1: H1FX transfected lysate(23.43 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |