FUBP3 monoclonal antibody (M03), clone 7B10 View larger

FUBP3 monoclonal antibody (M03), clone 7B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FUBP3 monoclonal antibody (M03), clone 7B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FUBP3 monoclonal antibody (M03), clone 7B10

Brand: Abnova
Reference: H00008939-M03
Product name: FUBP3 monoclonal antibody (M03), clone 7B10
Product description: Mouse monoclonal antibody raised against a partial recombinant FUBP3.
Clone: 7B10
Isotype: IgG2a Kappa
Gene id: 8939
Gene name: FUBP3
Gene alias: FBP3
Gene description: far upstream element (FUSE) binding protein 3
Genbank accession: BC007874
Immunogen: FUBP3 (AAH07874.1, 152 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LRITGDAFKVQQAREMVLEIIREKDQADFRGVRGDFNSRMGGGSIEVSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPEYYRQQVAFYGQTLGQAQAHSQEQ
Protein accession: AAH07874.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008939-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008939-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged FUBP3 is 0.3 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FUBP3 monoclonal antibody (M03), clone 7B10 now

Add to cart